SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5meqa2 (5meq A:182-276)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021514Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2021515Species Human (Homo sapiens) [TaxId:9606] [88605] (198 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2283719Domain d5meqa2: 5meq A:182-276 [327020]
    Other proteins in same PDB: d5meqa1, d5meqb1, d5meqb2
    automated match to d1ogaa1
    complexed with edo, so4

Details for d5meqa2

PDB Entry: 5meq (more details), 2.27 Å

PDB Description: human leukocyte antigen a02 presenting ilakflhtl
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5meqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5meqa2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d5meqa2:

Click to download the PDB-style file with coordinates for d5meqa2.
(The format of our PDB-style files is described here.)

Timeline for d5meqa2:

  • d5meqa2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5meqa1