Lineage for d5i76a2 (5i76 A:107-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2283690Species Homo sapiens/mus [TaxId:1383439] [326991] (2 PDB entries)
  8. 2283717Domain d5i76a2: 5i76 A:107-213 [327018]
    Other proteins in same PDB: d5i76a1, d5i76c1
    automated match to d1dn0a2

Details for d5i76a2

PDB Entry: 5i76 (more details), 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab
PDB Compounds: (A:) FM318_light_chain

SCOPe Domain Sequences for d5i76a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i76a2 b.1.1.2 (A:107-213) automated matches {Homo sapiens/mus [TaxId: 1383439]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

SCOPe Domain Coordinates for d5i76a2:

Click to download the PDB-style file with coordinates for d5i76a2.
(The format of our PDB-style files is described here.)

Timeline for d5i76a2:

  • d5i76a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5i76a1