Lineage for d5i76a1 (5i76 A:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365560Species Homo sapiens/mus [TaxId:1383439] [326989] (2 PDB entries)
  8. 2365563Domain d5i76a1: 5i76 A:1-106 [327017]
    Other proteins in same PDB: d5i76a2, d5i76c2
    automated match to d1dn0a1

Details for d5i76a1

PDB Entry: 5i76 (more details), 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab
PDB Compounds: (A:) FM318_light_chain

SCOPe Domain Sequences for d5i76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i76a1 b.1.1.0 (A:1-106) automated matches {Homo sapiens/mus [TaxId: 1383439]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklel

SCOPe Domain Coordinates for d5i76a1:

Click to download the PDB-style file with coordinates for d5i76a1.
(The format of our PDB-style files is described here.)

Timeline for d5i76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i76a2