Lineage for d2nb1c1 (2nb1 C:1002-1060)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998252Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1998253Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1998314Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 1998315Protein automated matches [259190] (2 species)
    not a true protein
  7. 1998316Species Human (Homo sapiens) [TaxId:9606] [311354] (4 PDB entries)
  8. 2283714Domain d2nb1c1: 2nb1 C:1002-1060 [327015]
    Other proteins in same PDB: d2nb1a2, d2nb1c2
    automated match to d3zy1a_

Details for d2nb1c1

PDB Entry: 2nb1 (more details)

PDB Description: p63/p73 hetero-tetramerisation domain
PDB Compounds: (C:) Tumor protein 63

SCOPe Domain Sequences for d2nb1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nb1c1 a.53.1.0 (C:1002-1060) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs

SCOPe Domain Coordinates for d2nb1c1:

Click to download the PDB-style file with coordinates for d2nb1c1.
(The format of our PDB-style files is described here.)

Timeline for d2nb1c1:

  • d2nb1c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d2nb1c2