SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nb1c1 (2nb1 C:1002-1060)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998252Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1998253Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1998314Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 1998315Protein automated matches [259190] (2 species)
    not a true protein
  7. 1998316Species Human (Homo sapiens) [TaxId:9606] [311354] (4 PDB entries)
  8. 2283714Domain d2nb1c1: 2nb1 C:1002-1060 [327015]
    Other proteins in same PDB: d2nb1a2, d2nb1c2
    automated match to d3zy1a_

Details for d2nb1c1

PDB Entry: 2nb1 (more details)

PDB Description: p63/p73 hetero-tetramerisation domain
PDB Compounds: (C:) Tumor protein 63

SCOPe Domain Sequences for d2nb1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nb1c1 a.53.1.0 (C:1002-1060) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs

SCOPe Domain Coordinates for d2nb1c1:

Click to download the PDB-style file with coordinates for d2nb1c1.
(The format of our PDB-style files is described here.)

Timeline for d2nb1c1:

  • d2nb1c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d2nb1c2