Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d5mere1: 5mer E:1-99 [327013] Other proteins in same PDB: d5mera1, d5mera2, d5merb2, d5merd1, d5merd2, d5mere2 automated match to d1duzb_ complexed with ca, edo, gol, mes, so4 |
PDB Entry: 5mer (more details), 1.88 Å
SCOPe Domain Sequences for d5mere1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mere1 b.1.1.2 (E:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d5mere1: