SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jmrb_ (5jmr B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (30 PDB entries)
  8. 2283709Domain d5jmrb_: 5jmr B: [327010]
    Other proteins in same PDB: d5jmra2
    automated match to d4kfzc_
    complexed with cl

Details for d5jmrb_

PDB Entry: 5jmr (more details), 2.27 Å

PDB Description: x-ray structure of the furin inhibitory antibody nb14
PDB Compounds: (B:) camelid VHH fragment

SCOPe Domain Sequences for d5jmrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jmrb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvs

SCOPe Domain Coordinates for d5jmrb_:

Click to download the PDB-style file with coordinates for d5jmrb_.
(The format of our PDB-style files is described here.)

Timeline for d5jmrb_:

  • d5jmrb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08