SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m62b1 (5m62 B:194-327)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2209773Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)
  8. 2283707Domain d5m62b1: 5m62 B:194-327 [327008]
    Other proteins in same PDB: d5m62a2, d5m62b2
    automated match to d4cajb_
    complexed with bgc, ca, glc, gol, p6g

Details for d5m62b1

PDB Entry: 5m62 (more details), 1.7 Å

PDB Description: structure of the mus musclus langerin carbohydrate recognition domain in complex with glucose
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d5m62b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m62b1 d.169.1.0 (B:194-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadgip
hwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswndgp
cdntflfickrpyv

SCOPe Domain Coordinates for d5m62b1:

Click to download the PDB-style file with coordinates for d5m62b1.
(The format of our PDB-style files is described here.)

Timeline for d5m62b1:

  • d5m62b1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5m62b2