Lineage for d5bozi_ (5boz I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024719Domain d5bozi_: 5boz I: [327007]
    Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_
    automated match to d4u7sa_
    complexed with cl, so4

Details for d5bozi_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (I:) VHH single chain antibody

SCOPe Domain Sequences for d5bozi_:

Sequence, based on SEQRES records: (download)

>d5bozi_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgttlygd
svkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqv
tvs

Sequence, based on observed residues (ATOM records): (download)

>d5bozi_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesggglvqaggslrlscaasfsrssmgwfrqapgkerefvasivwadgttlygdsvk
grftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqvtvs

SCOPe Domain Coordinates for d5bozi_:

Click to download the PDB-style file with coordinates for d5bozi_.
(The format of our PDB-style files is described here.)

Timeline for d5bozi_: