Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
Domain d5bozi_: 5boz I: [327007] Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_ automated match to d4u7sa_ complexed with cl, so4 |
PDB Entry: 5boz (more details), 3.1 Å
SCOPe Domain Sequences for d5bozi_:
Sequence, based on SEQRES records: (download)
>d5bozi_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]} qlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgttlygd svkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqv tvs
>d5bozi_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]} qlvesggglvqaggslrlscaasfsrssmgwfrqapgkerefvasivwadgttlygdsvk grftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqvtvs
Timeline for d5bozi_: