SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5laxd2 (5lax D:93-190)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022117Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2022125Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2283704Domain d5laxd2: 5lax D:93-190 [327005]
    Other proteins in same PDB: d5laxa1, d5laxa2, d5laxa3, d5laxb1, d5laxb3, d5laxc1, d5laxc2, d5laxd1, d5laxd3
    automated match to d1sebb1
    complexed with mla

Details for d5laxd2

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-4 beta chain

SCOPe Domain Sequences for d5laxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxd2 b.1.1.2 (D:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

SCOPe Domain Coordinates for d5laxd2:

Click to download the PDB-style file with coordinates for d5laxd2.
(The format of our PDB-style files is described here.)

Timeline for d5laxd2:

  • d5laxd2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08