SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5laxd1 (5lax D:4-92)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163749Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2163759Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (18 PDB entries)
  8. 2283703Domain d5laxd1: 5lax D:4-92 [327004]
    Other proteins in same PDB: d5laxa1, d5laxa2, d5laxa3, d5laxb2, d5laxb3, d5laxc1, d5laxc2, d5laxd2, d5laxd3
    automated match to d1klub2
    complexed with mla

Details for d5laxd1

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-4 beta chain

SCOPe Domain Sequences for d5laxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxd1 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
rprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywns
qkdlleqkraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d5laxd1:

Click to download the PDB-style file with coordinates for d5laxd1.
(The format of our PDB-style files is described here.)

Timeline for d5laxd1:

  • d5laxd1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08