Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Escherichia coli [TaxId:562] [326970] (1 PDB entry) |
Domain d5ji3a_: 5ji3 A: [327002] Other proteins in same PDB: d5ji3e_ automated match to d1e94a_ complexed with dat |
PDB Entry: 5ji3 (more details), 3 Å
SCOPe Domain Sequences for d5ji3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ji3a_ d.153.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d5ji3a_:
View in 3D Domains from other chains: (mouse over for more information) d5ji3b_, d5ji3c_, d5ji3d_, d5ji3e_ |