Lineage for d5bozk_ (5boz K:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (134 PDB entries)
  8. 2283696Domain d5bozk_: 5boz K: [326997]
    Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_
    automated match to d4u7sa_
    complexed with cl, so4

Details for d5bozk_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (K:) VHH single chain antibody

SCOPe Domain Sequences for d5bozk_:

Sequence, based on SEQRES records: (download)

>d5bozk_ b.1.1.1 (K:) automated matches {Llama (Lama glama) [TaxId: 9844]}
nmqvqlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgtt
lygdsvkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgq
gtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d5bozk_ b.1.1.1 (K:) automated matches {Llama (Lama glama) [TaxId: 9844]}
nmqvqlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgtt
lygdsvkgrftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgt
qvtvs

SCOPe Domain Coordinates for d5bozk_:

Click to download the PDB-style file with coordinates for d5bozk_.
(The format of our PDB-style files is described here.)

Timeline for d5bozk_:

  • d5bozk_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08