SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i76c2 (5i76 C:107-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2283690Species Homo sapiens/mus [TaxId:1383439] [326991] (1 PDB entry)
  8. 2283691Domain d5i76c2: 5i76 C:107-213 [326992]
    Other proteins in same PDB: d5i76a1, d5i76c1
    automated match to d1dn0a2

Details for d5i76c2

PDB Entry: 5i76 (more details), 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab
PDB Compounds: (C:) FM318_light_chain

SCOPe Domain Sequences for d5i76c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i76c2 b.1.1.2 (C:107-213) automated matches {Homo sapiens/mus [TaxId: 1383439]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

SCOPe Domain Coordinates for d5i76c2:

Click to download the PDB-style file with coordinates for d5i76c2.
(The format of our PDB-style files is described here.)

Timeline for d5i76c2:

  • d5i76c2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

2283691
d5i76c2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5i76c1