Lineage for d5i76c1 (5i76 C:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2283688Species Homo sapiens/mus [TaxId:1383439] [326989] (2 PDB entries)
  8. 2283689Domain d5i76c1: 5i76 C:1-106 [326990]
    Other proteins in same PDB: d5i76a2, d5i76c2
    automated match to d1dn0a1

Details for d5i76c1

PDB Entry: 5i76 (more details), 1.92 Å

PDB Description: crystal structure of fm318, a recombinant fab adopted from cetuximab
PDB Compounds: (C:) FM318_light_chain

SCOPe Domain Sequences for d5i76c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i76c1 b.1.1.0 (C:1-106) automated matches {Homo sapiens/mus [TaxId: 1383439]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklel

SCOPe Domain Coordinates for d5i76c1:

Click to download the PDB-style file with coordinates for d5i76c1.
(The format of our PDB-style files is described here.)

Timeline for d5i76c1:

  • d5i76c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5i76c2