SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ji3c_ (5ji3 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2283669Species Escherichia coli [TaxId:562] [326970] (1 PDB entry)
  8. 2283687Domain d5ji3c_: 5ji3 C: [326988]
    Other proteins in same PDB: d5ji3e_
    automated match to d1e94a_
    complexed with dat

Details for d5ji3c_

PDB Entry: 5ji3 (more details), 3 Å

PDB Description: hsluv complex
PDB Compounds: (C:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d5ji3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ji3c_ d.153.1.4 (C:) automated matches {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d5ji3c_:

Click to download the PDB-style file with coordinates for d5ji3c_.
(The format of our PDB-style files is described here.)

Timeline for d5ji3c_:

  • d5ji3c_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08