SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gjtl1 (5gjt L:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (859 PDB entries)
  8. 2283685Domain d5gjtl1: 5gjt L:1-106 [326986]
    Other proteins in same PDB: d5gjta1, d5gjta2, d5gjtb_, d5gjtl2
    automated match to d1dn0a1
    complexed with nag

Details for d5gjtl1

PDB Entry: 5gjt (more details), 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1
PDB Compounds: (L:) light chain of human neutralizing antibody 3E1

SCOPe Domain Sequences for d5gjtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjtl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspatlsasvgdrvsitcrasqsisswlawyqqkpgkapklliykasslesgvps
rfsgsgsgseftltisslqpddfaiyycqqynsypwtfgqgtkvei

SCOPe Domain Coordinates for d5gjtl1:

Click to download the PDB-style file with coordinates for d5gjtl1.
(The format of our PDB-style files is described here.)

Timeline for d5gjtl1:

  • d5gjtl1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08