Lineage for d5hn3a_ (5hn3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2283636Species Thermococcus kodakarensis [TaxId:69014] [326937] (4 PDB entries)
  8. 2283684Domain d5hn3a_: 5hn3 A: [326985]
    automated match to d1x0la_
    complexed with imd, na

Details for d5hn3a_

PDB Entry: 5hn3 (more details), 1.7 Å

PDB Description: crystal structure of beta-decarboxylating dehydrogenase (tk0280) from thermococcus kodakarensis (apo form)
PDB Compounds: (A:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d5hn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hn3a_ c.77.1.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr
sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg
igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev
ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg
dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp
dmggrartedvvrgiigeiedllsmdevwrde

SCOPe Domain Coordinates for d5hn3a_:

Click to download the PDB-style file with coordinates for d5hn3a_.
(The format of our PDB-style files is described here.)

Timeline for d5hn3a_:

  • d5hn3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08