SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l7ha1 (5l7h A:737-984)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2283680Domain d5l7ha1: 5l7h A:737-984 [326981]
    Other proteins in same PDB: d5l7ha2
    automated match to d2ovha_
    complexed with 6qg, nhe

Details for d5l7ha1

PDB Entry: 5l7h (more details), 1.84 Å

PDB Description: mcr in complex with ligand
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d5l7ha1:

Sequence, based on SEQRES records: (download)

>d5l7ha1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d5l7ha1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnsgqs
wqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnak
plyfhrk

SCOPe Domain Coordinates for d5l7ha1:

Click to download the PDB-style file with coordinates for d5l7ha1.
(The format of our PDB-style files is described here.)

Timeline for d5l7ha1:

  • d5l7ha1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08