Lineage for d5l7ha1 (5l7h A:737-984)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2283680Domain d5l7ha1: 5l7h A:737-984 [326981]
    Other proteins in same PDB: d5l7ha2
    automated match to d2ovha_
    complexed with 6qg, nhe

Details for d5l7ha1

PDB Entry: 5l7h (more details), 1.84 Å

PDB Description: mcr in complex with ligand
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d5l7ha1:

Sequence, based on SEQRES records: (download)

>d5l7ha1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhrk

Sequence, based on observed residues (ATOM records): (download)

>d5l7ha1 a.123.1.1 (A:737-984) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnsgqs
wqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnak
plyfhrk

SCOPe Domain Coordinates for d5l7ha1:

Click to download the PDB-style file with coordinates for d5l7ha1.
(The format of our PDB-style files is described here.)

Timeline for d5l7ha1:

  • d5l7ha1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08