SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jmra1 (5jmr A:1-116)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (30 PDB entries)
  8. 2283678Domain d5jmra1: 5jmr A:1-116 [326979]
    Other proteins in same PDB: d5jmra2
    automated match to d4kfzc_
    complexed with cl

Details for d5jmra1

PDB Entry: 5jmr (more details), 2.27 Å

PDB Description: x-ray structure of the furin inhibitory antibody nb14
PDB Compounds: (A:) camelid VHH fragment

SCOPe Domain Sequences for d5jmra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jmra1 b.1.1.1 (A:1-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvs

SCOPe Domain Coordinates for d5jmra1:

Click to download the PDB-style file with coordinates for d5jmra1.
(The format of our PDB-style files is described here.)

Timeline for d5jmra1:

  • d5jmra1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5jmra2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jmrb_