SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l4ra_ (5l4r A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041900Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2041901Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2041902Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2041910Protein Thaumatin [49876] (1 species)
  7. 2041911Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (84 PDB entries)
    Uniprot P02883
  8. 2283677Domain d5l4ra_: 5l4r A: [326978]
    automated match to d1kwna_
    complexed with 73m, cpt, gol, tla

Details for d5l4ra_

PDB Entry: 5l4r (more details), 1.45 Å

PDB Description: x-ray structure of the adduct between thaumatin and cisplatin
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5l4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l4ra_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5l4ra_:

Click to download the PDB-style file with coordinates for d5l4ra_.
(The format of our PDB-style files is described here.)

Timeline for d5l4ra_:

  • d5l4ra_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08