Lineage for d5k8yb1 (5k8y B:194-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002721Domain d5k8yb1: 5k8y B:194-327 [326976]
    Other proteins in same PDB: d5k8ya2, d5k8yb2
    automated match to d3c22d_
    complexed with ca, gol, p6g

Details for d5k8yb1

PDB Entry: 5k8y (more details), 2.4 Å

PDB Description: structure of the mus musclus langerin carbohydrate recognition domain
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d5k8yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k8yb1 d.169.1.0 (B:194-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadgip
hwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwndgp
cdntflfickrpyv

SCOPe Domain Coordinates for d5k8yb1:

Click to download the PDB-style file with coordinates for d5k8yb1.
(The format of our PDB-style files is described here.)

Timeline for d5k8yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k8yb2