Lineage for d5h7xe1 (5h7x E:1-163)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119573Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries)
  8. 2119578Domain d5h7xe1: 5h7x E:1-163 [326974]
    Other proteins in same PDB: d5h7xe2, d5h7xf2
    automated match to d3f3ma_
    complexed with cit

Details for d5h7xe1

PDB Entry: 5h7x (more details), 1.76 Å

PDB Description: crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2, 3-propane tricarboxylate at 1.76 a resolution
PDB Compounds: (E:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5h7xe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7xe1 c.26.1.0 (E:1-163) automated matches {Acinetobacter baumannii [TaxId: 470]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

SCOPe Domain Coordinates for d5h7xe1:

Click to download the PDB-style file with coordinates for d5h7xe1.
(The format of our PDB-style files is described here.)

Timeline for d5h7xe1: