Lineage for d5ji3e_ (5ji3 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113595Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 2113596Species Escherichia coli [TaxId:562] [52722] (11 PDB entries)
  8. 2283672Domain d5ji3e_: 5ji3 E: [326973]
    Other proteins in same PDB: d5ji3a_, d5ji3b_, d5ji3c_, d5ji3d_
    automated match to d1g4ae_
    complexed with dat

Details for d5ji3e_

PDB Entry: 5ji3 (more details), 3 Å

PDB Description: hsluv complex
PDB Compounds: (E:) ATP-dependent protease ATPase subunit HslU

SCOPe Domain Sequences for d5ji3e_:

Sequence, based on SEQRES records: (download)

>d5ji3e_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d5ji3e_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftegkevdsiirdltdaavkmvrvqaieknryrae
elaeerildvlippaepsaarqafrkklregqkikdamkllieeeaaklvnpeelkqdai
daveqhgivfideidkicksgpdvsregvqrdllplvegctvstkhgmvktdhilfiasg
afqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmategvnief
tdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitidadyvskh
ldalvadedlsrfil

SCOPe Domain Coordinates for d5ji3e_:

Click to download the PDB-style file with coordinates for d5ji3e_.
(The format of our PDB-style files is described here.)

Timeline for d5ji3e_:

  • d5ji3e_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08