SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ji3e_ (5ji3 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113595Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 2113596Species Escherichia coli [TaxId:562] [52722] (11 PDB entries)
  8. 2283672Domain d5ji3e_: 5ji3 E: [326973]
    Other proteins in same PDB: d5ji3a_, d5ji3b_, d5ji3c_, d5ji3d_
    automated match to d1g4ae_
    complexed with dat

Details for d5ji3e_

PDB Entry: 5ji3 (more details), 3 Å

PDB Description: hsluv complex
PDB Compounds: (E:) ATP-dependent protease ATPase subunit HslU

SCOPe Domain Sequences for d5ji3e_:

Sequence, based on SEQRES records: (download)

>d5ji3e_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d5ji3e_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftegkevdsiirdltdaavkmvrvqaieknryrae
elaeerildvlippaepsaarqafrkklregqkikdamkllieeeaaklvnpeelkqdai
daveqhgivfideidkicksgpdvsregvqrdllplvegctvstkhgmvktdhilfiasg
afqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmategvnief
tdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitidadyvskh
ldalvadedlsrfil

SCOPe Domain Coordinates for d5ji3e_:

Click to download the PDB-style file with coordinates for d5ji3e_.
(The format of our PDB-style files is described here.)

Timeline for d5ji3e_:

  • d5ji3e_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08