![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries) |
![]() | Domain d5dakb1: 5dak B:77-209 [326965] Other proteins in same PDB: d5daka2, d5dakb2 automated match to d13gsa1 complexed with ars, mes |
PDB Entry: 5dak (more details), 2.11 Å
SCOPe Domain Sequences for d5dakb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dakb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d5dakb1: