SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j56b_ (5j56 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (117 PDB entries)
  8. 2283663Domain d5j56b_: 5j56 B: [326964]
    Other proteins in same PDB: d5j56a_
    automated match to d5da4a_
    complexed with acy, cl, edo, pg4

Details for d5j56b_

PDB Entry: 5j56 (more details), 1.8 Å

PDB Description: rta-v1c7
PDB Compounds: (B:) v1c7

SCOPe Domain Sequences for d5j56b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j56b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
aqvqlvesggglvqpggslrlscvasefsgftldyyaigwfrqapgkereglssissssd
gftsysdsvkgrftisrdnakntvylqmnslkpedtavyycaarlggwasfspqeydywg
qgtqvtvss

SCOPe Domain Coordinates for d5j56b_:

Click to download the PDB-style file with coordinates for d5j56b_.
(The format of our PDB-style files is described here.)

Timeline for d5j56b_:

  • d5j56b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08