SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kkbb_ (5kkb B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004347Species Mouse (Mus musculus) [TaxId:10090] [101367] (2 PDB entries)
  8. 2283662Domain d5kkbb_: 5kkb B: [326963]
    automated match to d1nxca_
    complexed with 1ps, bma, bu1, la, man, nag

Details for d5kkbb_

PDB Entry: 5kkb (more details), 1.77 Å

PDB Description: structure of mouse golgi alpha-1,2-mannosidase ia and man9glcnac2-pa complex
PDB Compounds: (B:) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

SCOPe Domain Sequences for d5kkbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkbb_ a.102.2.1 (B:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
vdflppvgvenrepadatirekrakikemmthawnnykryawglnelkpiskeghssslf
gnikgativdaldtlfimgmktefqeakswikkyldfnvnaevsvfevnirfvggllsay
ylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasggssilaefgtl
hlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglgd
sfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmgh
ltcfaggmfalgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveai
atrqnekyyilrpevietymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyi
aresyddvqqsfflaetlkylylifsdddllplehwifnteahpfpilr

SCOPe Domain Coordinates for d5kkbb_:

Click to download the PDB-style file with coordinates for d5kkbb_.
(The format of our PDB-style files is described here.)

Timeline for d5kkbb_:

  • d5kkbb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08