SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j56a_ (5j56 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207818Protein Ricin A-chain [56389] (1 species)
  7. 2207819Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (47 PDB entries)
    Uniprot P06750 28-286
  8. 2283660Domain d5j56a_: 5j56 A: [326961]
    Other proteins in same PDB: d5j56b_
    automated match to d1br6a_
    complexed with acy, cl, edo, pg4

Details for d5j56a_

PDB Entry: 5j56 (more details), 1.8 Å

PDB Description: rta-v1c7
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d5j56a_:

Sequence, based on SEQRES records: (download)

>d5j56a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrc

Sequence, based on observed residues (ATOM records): (download)

>d5j56a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttadvrheipvlpnrvglpinqrfilvelsnh
aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrc

SCOPe Domain Coordinates for d5j56a_:

Click to download the PDB-style file with coordinates for d5j56a_.
(The format of our PDB-style files is described here.)

Timeline for d5j56a_:

  • d5j56a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08