Lineage for d5gjsa1 (5gjs A:11-333)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (23 species)
    not a true protein
  7. 2040858Species Influenza A virus [TaxId:641501] [256167] (3 PDB entries)
  8. 2283659Domain d5gjsa1: 5gjs A:11-333 [326960]
    Other proteins in same PDB: d5gjsa2, d5gjsb_, d5gjsl1, d5gjsl2
    automated match to d3ztna_
    complexed with nag

Details for d5gjsa1

PDB Entry: 5gjs (more details), 2.9 Å

PDB Description: crystal structure of h1 hemagglutinin from a/california/04/2009 in complex with a neutralizing antibody 3e1
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5gjsa1:

Sequence, based on SEQRES records: (download)

>d5gjsa1 b.19.1.2 (A:11-333) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

Sequence, based on observed residues (ATOM records): (download)

>d5gjsa1 b.19.1.2 (A:11-333) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpecestasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktss
wpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhp
stsadqqslynadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfe
atgnlvvpryafamernasgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcp
kyvkstklrlatglrnips

SCOPe Domain Coordinates for d5gjsa1:

Click to download the PDB-style file with coordinates for d5gjsa1.
(The format of our PDB-style files is described here.)

Timeline for d5gjsa1:

  • d5gjsa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08