SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gjsb_ (5gjs B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (18 species)
    not a true protein
  7. 2239662Species Influenza a virus [TaxId:1454272] [275804] (3 PDB entries)
  8. 2283657Domain d5gjsb_: 5gjs B: [326958]
    Other proteins in same PDB: d5gjsa1, d5gjsa2, d5gjsl1, d5gjsl2
    automated match to d5bnyf_
    complexed with nag

Details for d5gjsb_

PDB Entry: 5gjs (more details), 2.9 Å

PDB Description: crystal structure of h1 hemagglutinin from a/california/04/2009 in complex with a neutralizing antibody 3e1
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5gjsb_:

Sequence, based on SEQRES records: (download)

>d5gjsb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
gaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmntqf
tavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvr
sqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

Sequence, based on observed residues (ATOM records): (download)

>d5gjsb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
gaiafieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmntqft
avgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrs
qlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

SCOPe Domain Coordinates for d5gjsb_:

Click to download the PDB-style file with coordinates for d5gjsb_.
(The format of our PDB-style files is described here.)

Timeline for d5gjsb_:

  • d5gjsb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08