SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hn6a_ (5hn6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2283636Species Thermococcus kodakarensis [TaxId:69014] [326937] (4 PDB entries)
  8. 2283656Domain d5hn6a_: 5hn6 A: [326957]
    automated match to d1x0la_
    complexed with ipm, mn, mpd

Details for d5hn6a_

PDB Entry: 5hn6 (more details), 2.5 Å

PDB Description: crystal structure of beta-decarboxylating dehydrogenase (tk0280) from thermococcus kodakarensis complexed with mn and 3-isopropylmalate
PDB Compounds: (A:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d5hn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hn6a_ c.77.1.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr
sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg
igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev
ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg
dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp
dmggrartedvvrgiigeiedllsmdevw

SCOPe Domain Coordinates for d5hn6a_:

Click to download the PDB-style file with coordinates for d5hn6a_.
(The format of our PDB-style files is described here.)

Timeline for d5hn6a_:

  • d5hn6a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08