Lineage for d5ez5b_ (5ez5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (126 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (123 PDB entries)
  8. 2283655Domain d5ez5b_: 5ez5 B: [326956]
    automated match to d4uj3d_
    complexed with gtp, mg

Details for d5ez5b_

PDB Entry: 5ez5 (more details), 2.4 Å

PDB Description: crystal structure of active rab11a (s20v) in complex with gtp
PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d5ez5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ez5b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdvgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

SCOPe Domain Coordinates for d5ez5b_:

Click to download the PDB-style file with coordinates for d5ez5b_.
(The format of our PDB-style files is described here.)

Timeline for d5ez5b_:

  • d5ez5b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08