SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f05a2 (5f05 A:83-212)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2283560Species Populus trichocarpa [TaxId:3694] [326861] (4 PDB entries)
  8. 2283650Domain d5f05a2: 5f05 A:83-212 [326951]
    Other proteins in same PDB: d5f05a1, d5f05b1, d5f05c1, d5f05d1
    automated match to d1aw9a1
    complexed with 12p, gol, gsh, mg, pg4, pge

Details for d5f05a2

PDB Entry: 5f05 (more details), 1.7 Å

PDB Description: crystal structure of glutathione transferase f5 from populus trichocarpa
PDB Compounds: (A:) Phi class glutathione transferase GSTF5

SCOPe Domain Sequences for d5f05a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f05a2 a.45.1.0 (A:83-212) automated matches {Populus trichocarpa [TaxId: 3694]}
gtqlgaagngyatilvwqeveshqfdpsasklvweqvfkpvfglptdaalvaetevtlgk
vldvyearlsqskylasdsftladlhhlpniqallgtpskklfdsrphvsawvasitgrp
awgkvlallp

SCOPe Domain Coordinates for d5f05a2:

Click to download the PDB-style file with coordinates for d5f05a2.
(The format of our PDB-style files is described here.)

Timeline for d5f05a2:

  • d5f05a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08