SCOPe 2.08: Domain d5f05a2: 5f05 A:83-212

Lineage for d5f05a2 (5f05 A:83-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries)

8. Domain d5f05a2: 5f05 A:83-212 [326951]
   Other proteins in same PDB: d5f05a1, d5f05b1, d5f05c1, d5f05d1
   automated match to d1aw9a1
   complexed with 12p, gol, gsh, mg, pg4, pge

Details for d5f05a2

PDB Entry: 5f05, 1.7 Å

PDB Description: crystal structure of glutathione transferase f5 from populus trichocarpa

PDB Compounds: (A:) Phi class glutathione transferase GSTF5

SCOPe Domain Sequences for d5f05a2:

Sequence; same for both SEQRES and ATOM records:

>d5f05a2 a.45.1.0 (A:83-212) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gtqlgaagngyatilvwqeveshqfdpsasklvweqvfkpvfglptdaalvaetevtlgk
vldvyearlsqskylasdsftladlhhlpniqallgtpskklfdsrphvsawvasitgrp
awgkvlallp

Timeline for d5f05a2:

• d5f05a2 first appeared in SCOPe 2.06
  
• d5f05a2 appears in SCOPe 2.07