SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j57a_ (5j57 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2207717Family d.165.1.1: Plant cytotoxins [56372] (18 protein domains)
  6. 2207818Protein Ricin A-chain [56389] (1 species)
  7. 2207819Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (47 PDB entries)
    Uniprot P06750 28-286
  8. 2283645Domain d5j57a_: 5j57 A: [326946]
    Other proteins in same PDB: d5j57b_
    automated match to d1br6a_
    complexed with cl, edo

Details for d5j57a_

PDB Entry: 5j57 (more details), 1.7 Å

PDB Description: v5e1-rta complex
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d5j57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j57a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d5j57a_:

Click to download the PDB-style file with coordinates for d5j57a_.
(The format of our PDB-style files is described here.)

Timeline for d5j57a_:

  • d5j57a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08