SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h7xc_ (5h7x C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2281583Species Acinetobacter baumannii [TaxId:470] [324884] (2 PDB entries)
  8. 2283644Domain d5h7xc_: 5h7x C: [326945]
    Other proteins in same PDB: d5h7xe2, d5h7xf2
    automated match to d3f3ma_
    complexed with cit

Details for d5h7xc_

PDB Entry: 5h7x (more details), 1.76 Å

PDB Description: crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2, 3-propane tricarboxylate at 1.76 a resolution
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5h7xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7xc_ c.26.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

SCOPe Domain Coordinates for d5h7xc_:

Click to download the PDB-style file with coordinates for d5h7xc_.
(The format of our PDB-style files is described here.)

Timeline for d5h7xc_:

  • d5h7xc_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08