Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
Protein automated matches [190603] (25 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [326937] (4 PDB entries) |
Domain d5hn4a_: 5hn4 A: [326938] automated match to d1x0la_ complexed with 48y, imd, ipa, mn |
PDB Entry: 5hn4 (more details), 2.64 Å
SCOPe Domain Sequences for d5hn4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hn4a_ c.77.1.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp dmggrartedvvrgiigeiedllsmdevw
Timeline for d5hn4a_: