Lineage for d5hn4a_ (5hn4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906408Species Thermococcus kodakarensis [TaxId:69014] [326937] (4 PDB entries)
  8. 2906412Domain d5hn4a_: 5hn4 A: [326938]
    automated match to d1x0la_
    complexed with 48y, imd, ipa, mn

Details for d5hn4a_

PDB Entry: 5hn4 (more details), 2.64 Å

PDB Description: crystal structure of beta-decarboxylating dehydrogenase (tk0280) from thermococcus kodakarensis complexed with mn and homoisocitrate
PDB Compounds: (A:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d5hn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hn4a_ c.77.1.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr
sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg
igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev
ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg
dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp
dmggrartedvvrgiigeiedllsmdevw

SCOPe Domain Coordinates for d5hn4a_:

Click to download the PDB-style file with coordinates for d5hn4a_.
(The format of our PDB-style files is described here.)

Timeline for d5hn4a_: