Lineage for d5gjsl1 (5gjs L:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (877 PDB entries)
  8. 2283633Domain d5gjsl1: 5gjs L:1-106 [326934]
    Other proteins in same PDB: d5gjsa1, d5gjsa2, d5gjsb_, d5gjsl2
    automated match to d1dn0a1
    complexed with nag

Details for d5gjsl1

PDB Entry: 5gjs (more details), 2.9 Å

PDB Description: crystal structure of h1 hemagglutinin from a/california/04/2009 in complex with a neutralizing antibody 3e1
PDB Compounds: (L:) light chain of human neutralizing antibody 3E1

SCOPe Domain Sequences for d5gjsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjsl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspatlsasvgdrvsitcrasqsisswlawyqqkpgkapklliykasslesgvps
rfsgsgsgseftltisslqpddfaiyycqqynsypwtfgqgtkvei

SCOPe Domain Coordinates for d5gjsl1:

Click to download the PDB-style file with coordinates for d5gjsl1.
(The format of our PDB-style files is described here.)

Timeline for d5gjsl1:

  • d5gjsl1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08