SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f07a2 (5f07 A:82-213)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2283560Species Populus trichocarpa [TaxId:3694] [326861] (4 PDB entries)
  8. 2283632Domain d5f07a2: 5f07 A:82-213 [326933]
    Other proteins in same PDB: d5f07a1
    automated match to d4ri6a2
    complexed with gsh

Details for d5f07a2

PDB Entry: 5f07 (more details), 1.5 Å

PDB Description: crystal structure of glutathione transferase f8 from populus trichocarpa
PDB Compounds: (A:) Putative glutathione S-transferase family protein

SCOPe Domain Sequences for d5f07a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f07a2 a.45.1.0 (A:82-213) automated matches {Populus trichocarpa [TaxId: 3694]}
gpnllgntleekalvdqwleieahnfndlvfnivfqvvilprigqqgdselvrtyeekle
kvldvyekrlskskylagdsftladlshlpatrylvneaglghlvkdrkklnawwediss
rpawkklmnlag

SCOPe Domain Coordinates for d5f07a2:

Click to download the PDB-style file with coordinates for d5f07a2.
(The format of our PDB-style files is described here.)

Timeline for d5f07a2:

  • d5f07a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f07a1