SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f07a1 (5f07 A:2-81)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (160 species)
    not a true protein
  7. 2120119Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (6 PDB entries)
  8. 2283631Domain d5f07a1: 5f07 A:2-81 [326932]
    Other proteins in same PDB: d5f07a2
    automated match to d4ri7a1
    complexed with gsh

Details for d5f07a1

PDB Entry: 5f07 (more details), 1.5 Å

PDB Description: crystal structure of glutathione transferase f8 from populus trichocarpa
PDB Compounds: (A:) Putative glutathione S-transferase family protein

SCOPe Domain Sequences for d5f07a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f07a1 c.47.1.0 (A:2-81) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
vvkvygpavavcpqrvmacllekgvefdlvhvdldsgeqklpefllkqpfgqvpvvedgd
fklfesraiiryyaakyedr

SCOPe Domain Coordinates for d5f07a1:

Click to download the PDB-style file with coordinates for d5f07a1.
(The format of our PDB-style files is described here.)

Timeline for d5f07a1:

  • d5f07a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f07a2