SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gp1a_ (5gp1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2283621Species Zika virus [TaxId:64320] [326922] (1 PDB entry)
  8. 2283622Domain d5gp1a_: 5gp1 A: [326923]
    automated match to d2oxta_
    complexed with gta, ni, sah, so4

Details for d5gp1a_

PDB Entry: 5gp1 (more details), 2.44 Å

PDB Description: crystal structure of zikv ns5 methyltransferase in complex with gtp and sah
PDB Compounds: (A:) RNA-directed RNA polymerase NS5

SCOPe Domain Sequences for d5gp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gp1a_ c.66.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
tgetlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklr
wlvergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwni
vrlksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikv
lcpytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgr
mdgprrpvkyeedvnlgsgtra

SCOPe Domain Coordinates for d5gp1a_:

Click to download the PDB-style file with coordinates for d5gp1a_.
(The format of our PDB-style files is described here.)

Timeline for d5gp1a_:

  • d5gp1a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08