Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) |
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
Protein Urease, beta-subunit [51280] (4 species) |
Species Bacillus pasteurii [TaxId:1474] [51282] (11 PDB entries) |
Domain d5g4hb_: 5g4h B: [326921] Other proteins in same PDB: d5g4ha_ automated match to d1s3tb_ complexed with caq, edo, ni, oh, so4 |
PDB Entry: 5g4h (more details), 1.5 Å
SCOPe Domain Sequences for d5g4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g4hb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d5g4hb_: