SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g4hb_ (5g4h B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072509Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2072510Family b.85.3.1: Urease, beta-subunit [51279] (2 protein domains)
  6. 2072511Protein Urease, beta-subunit [51280] (4 species)
  7. 2072512Species Bacillus pasteurii [TaxId:1474] [51282] (11 PDB entries)
  8. 2283620Domain d5g4hb_: 5g4h B: [326921]
    Other proteins in same PDB: d5g4ha_
    automated match to d1s3tb_
    complexed with caq, edo, ni, oh, so4

Details for d5g4hb_

PDB Entry: 5g4h (more details), 1.5 Å

PDB Description: 1.50 a resolution catechol (1,2-dihydroxybenzene) inhibited sporosarcina pasteurii urease
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d5g4hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4hb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d5g4hb_:

Click to download the PDB-style file with coordinates for d5g4hb_.
(The format of our PDB-style files is described here.)

Timeline for d5g4hb_:

  • d5g4hb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08