Lineage for d5gjta1 (5gjt A:11-332)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (23 species)
    not a true protein
  7. 2040858Species Influenza A virus [TaxId:641501] [256167] (3 PDB entries)
  8. 2283616Domain d5gjta1: 5gjt A:11-332 [326917]
    Other proteins in same PDB: d5gjta2, d5gjtb_, d5gjtl1, d5gjtl2
    automated match to d3ztna_
    complexed with nag

Details for d5gjta1

PDB Entry: 5gjt (more details), 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5gjta1:

Sequence, based on SEQRES records: (download)

>d5gjta1 b.19.1.2 (A:11-332) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d5gjta1 b.19.1.2 (A:11-332) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigk
cpkyvkstklrlatglrnvp

SCOPe Domain Coordinates for d5gjta1:

Click to download the PDB-style file with coordinates for d5gjta1.
(The format of our PDB-style files is described here.)

Timeline for d5gjta1:

  • d5gjta1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08