SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gjta1 (5gjt A:11-332)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (22 species)
    not a true protein
  7. 2040858Species Influenza A virus [TaxId:641501] [256167] (3 PDB entries)
  8. 2283616Domain d5gjta1: 5gjt A:11-332 [326917]
    Other proteins in same PDB: d5gjta2, d5gjtb_, d5gjtl1, d5gjtl2
    automated match to d3ztna_
    complexed with nag

Details for d5gjta1

PDB Entry: 5gjt (more details), 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5gjta1:

Sequence, based on SEQRES records: (download)

>d5gjta1 b.19.1.2 (A:11-332) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnvp

Sequence, based on observed residues (ATOM records): (download)

>d5gjta1 b.19.1.2 (A:11-332) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigk
cpkyvkstklrlatglrnvp

SCOPe Domain Coordinates for d5gjta1:

Click to download the PDB-style file with coordinates for d5gjta1.
(The format of our PDB-style files is described here.)

Timeline for d5gjta1:

  • d5gjta1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08