SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5bozj_ (5boz J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (128 PDB entries)
  8. 2283613Domain d5bozj_: 5boz J: [326914]
    Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_
    automated match to d4u7sa_
    complexed with cl, so4

Details for d5bozj_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (J:) VHH single chain antibody

SCOPe Domain Sequences for d5bozj_:

Sequence, based on SEQRES records: (download)

>d5bozj_ b.1.1.1 (J:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgttlygd
svkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqv
tvs

Sequence, based on observed residues (ATOM records): (download)

>d5bozj_ b.1.1.1 (J:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesggglvqaggslrlscaastfsrssmgwfrqapgkerefvasivwadgttlygdsv
kgrftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqvtvs

SCOPe Domain Coordinates for d5bozj_:

Click to download the PDB-style file with coordinates for d5bozj_.
(The format of our PDB-style files is described here.)

Timeline for d5bozj_:

  • d5bozj_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08