Lineage for d5f68a_ (5f68 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210987Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2210988Protein automated matches [190492] (20 species)
    not a true protein
  7. 2211016Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226626] (5 PDB entries)
  8. 2211017Domain d5f68a_: 5f68 A: [326913]
    automated match to d2a24a_
    complexed with edo

Details for d5f68a_

PDB Entry: 5f68 (more details), 1.23 Å

PDB Description: drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
PDB Compounds: (A:) Protein cycle

SCOPe Domain Sequences for d5f68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f68a_ d.110.3.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mfisrhsgegkflfidqratlvigflpqeilgtsfyeyfhnediaalmeshkmvmqvpek
vttqvyrfrckdnsyiqlqsewrafknpatseidyiiaknsvf

SCOPe Domain Coordinates for d5f68a_:

Click to download the PDB-style file with coordinates for d5f68a_.
(The format of our PDB-style files is described here.)

Timeline for d5f68a_: