SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f68a_ (5f68 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (19 species)
    not a true protein
  7. 2189204Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226626] (5 PDB entries)
  8. 2283612Domain d5f68a_: 5f68 A: [326913]
    automated match to d2a24a_
    complexed with edo

Details for d5f68a_

PDB Entry: 5f68 (more details), 1.23 Å

PDB Description: drosophila melanogaster cycle w398a pas-b with bound ethylene glycol
PDB Compounds: (A:) Protein cycle

SCOPe Domain Sequences for d5f68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f68a_ d.110.3.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mfisrhsgegkflfidqratlvigflpqeilgtsfyeyfhnediaalmeshkmvmqvpek
vttqvyrfrckdnsyiqlqsewrafknpatseidyiiaknsvf

SCOPe Domain Coordinates for d5f68a_:

Click to download the PDB-style file with coordinates for d5f68a_.
(The format of our PDB-style files is described here.)

Timeline for d5f68a_:

  • d5f68a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07