![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains) |
![]() | Protein automated matches [190119] (19 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (41 PDB entries) |
![]() | Domain d5bozg_: 5boz G: [326908] Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_ automated match to d4u7sa_ complexed with cl, so4 |
PDB Entry: 5boz (more details), 3.1 Å
SCOPe Domain Sequences for d5bozg_:
Sequence, based on SEQRES records: (download)
>d5bozg_ b.1.1.1 (G:) automated matches {Vicugna pacos [TaxId: 30538]} mqvqlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgttl ygdsvkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqg tqvtvs
>d5bozg_ b.1.1.1 (G:) automated matches {Vicugna pacos [TaxId: 30538]} mqvqlvesggglvqaggslrlscaasrtfsrssmgwfrqapgkerefvasivwadgttly gdsvkgrftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqv tvs
Timeline for d5bozg_: