Lineage for d5g49b_ (5g49 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987129Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 protein domains)
  6. 1987187Protein automated matches [194413] (3 species)
    not a true protein
  7. 2283597Species Arabidopsis thaliana [TaxId:3702] [326898] (1 PDB entry)
  8. 2283603Domain d5g49b_: 5g49 B: [326904]
    Other proteins in same PDB: d5g49a2
    automated match to d4csrb_
    complexed with act, ca

Details for d5g49b_

PDB Entry: 5g49 (more details), 2.3 Å

PDB Description: crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
PDB Compounds: (B:) nuclear transcription factor y subunit c-3

SCOPe Domain Sequences for d5g49b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g49b_ a.22.1.3 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
tqfkeiekttdfknhslplarikkimkadedvrmisaeapvvfaracemfileltlrswn
hteenkrrtlqkndiaaavtrtdifdflvdivpr

SCOPe Domain Coordinates for d5g49b_:

Click to download the PDB-style file with coordinates for d5g49b_.
(The format of our PDB-style files is described here.)

Timeline for d5g49b_:

  • d5g49b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07