Lineage for d5g49a1 (5g49 A:55-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699191Protein automated matches [194413] (5 species)
    not a true protein
  7. 2699207Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries)
  8. 2699214Domain d5g49a1: 5g49 A:55-147 [326899]
    Other proteins in same PDB: d5g49a2
    automated match to d4g92b_
    complexed with act, ca

Details for d5g49a1

PDB Entry: 5g49 (more details), 2.3 Å

PDB Description: crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
PDB Compounds: (A:) nuclear transcription factor y subunit b-6

SCOPe Domain Sequences for d5g49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g49a1 a.22.1.3 (A:55-147) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tvreqdrfmpianvirimrrilpahakisddsketiqecvseyisfitgeanercqreqr
ktitaedvlwamsklgfddyiepltlylhryre

SCOPe Domain Coordinates for d5g49a1:

Click to download the PDB-style file with coordinates for d5g49a1.
(The format of our PDB-style files is described here.)

Timeline for d5g49a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g49a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5g49b_