SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g49a1 (5g49 A:55-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987129Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 protein domains)
  6. 1987187Protein automated matches [194413] (3 species)
    not a true protein
  7. 2283597Species Arabidopsis thaliana [TaxId:3702] [326898] (1 PDB entry)
  8. 2283598Domain d5g49a1: 5g49 A:55-147 [326899]
    Other proteins in same PDB: d5g49a2
    automated match to d4g92b_
    complexed with act, ca

Details for d5g49a1

PDB Entry: 5g49 (more details), 2.3 Å

PDB Description: crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
PDB Compounds: (A:) nuclear transcription factor y subunit b-6

SCOPe Domain Sequences for d5g49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g49a1 a.22.1.3 (A:55-147) automated matches {Arabidopsis thaliana [TaxId: 3702]}
tvreqdrfmpianvirimrrilpahakisddsketiqecvseyisfitgeanercqreqr
ktitaedvlwamsklgfddyiepltlylhryre

SCOPe Domain Coordinates for d5g49a1:

Click to download the PDB-style file with coordinates for d5g49a1.
(The format of our PDB-style files is described here.)

Timeline for d5g49a1:

  • d5g49a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-07

View in 3D
Domains from same chain:
(mouse over for more information)
d5g49a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5g49b_