Lineage for d5g4ha_ (5g4h A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499158Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2499159Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2499160Family d.8.1.1: Urease, gamma-subunit [54112] (2 protein domains)
    automatically mapped to Pfam PF00547
  6. 2499209Protein automated matches [279671] (1 species)
    not a true protein
  7. 2499210Species Sporosarcina pasteurii [TaxId:1474] [279673] (5 PDB entries)
  8. 2499211Domain d5g4ha_: 5g4h A: [326887]
    Other proteins in same PDB: d5g4hb_
    automated match to d4ubpa_
    complexed with caq, edo, ni, oh, so4

Details for d5g4ha_

PDB Entry: 5g4h (more details), 1.5 Å

PDB Description: 1.50 a resolution catechol (1,2-dihydroxybenzene) inhibited sporosarcina pasteurii urease
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d5g4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4ha_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d5g4ha_:

Click to download the PDB-style file with coordinates for d5g4ha_.
(The format of our PDB-style files is described here.)

Timeline for d5g4ha_: