SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g4ha_ (5g4h A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156426Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2156427Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2156428Family d.8.1.1: Urease, gamma-subunit [54112] (2 protein domains)
    automatically mapped to Pfam PF00547
  6. 2156477Protein automated matches [279671] (1 species)
    not a true protein
  7. 2156478Species Sporosarcina pasteurii [TaxId:1474] [279673] (4 PDB entries)
  8. 2283586Domain d5g4ha_: 5g4h A: [326887]
    Other proteins in same PDB: d5g4hb_
    automated match to d4ubpa_
    complexed with caq, edo, ni, oh, so4

Details for d5g4ha_

PDB Entry: 5g4h (more details), 1.5 Å

PDB Description: 1.50 a resolution catechol (1,2-dihydroxybenzene) inhibited sporosarcina pasteurii urease
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d5g4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4ha_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d5g4ha_:

Click to download the PDB-style file with coordinates for d5g4ha_.
(The format of our PDB-style files is described here.)

Timeline for d5g4ha_:

  • d5g4ha_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-07