SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ey3a3 (5ey3 A:336-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169000Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2169018Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2169019Protein automated matches [254643] (5 species)
    not a true protein
  7. 2169027Species Salmonella typhimurium [TaxId:99287] [311467] (3 PDB entries)
  8. 2283578Domain d5ey3a3: 5ey3 A:336-440 [326879]
    Other proteins in same PDB: d5ey3a1, d5ey3a2, d5ey3a4, d5ey3b1, d5ey3b2
    automated match to d4x46b3
    complexed with ctn, edo, gol, so4

Details for d5ey3a3

PDB Entry: 5ey3 (more details), 1.91 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d5ey3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ey3a3 d.41.3.0 (A:336-440) automated matches {Salmonella typhimurium [TaxId: 99287]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

SCOPe Domain Coordinates for d5ey3a3:

Click to download the PDB-style file with coordinates for d5ey3a3.
(The format of our PDB-style files is described here.)

Timeline for d5ey3a3:

  • d5ey3a3 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08